IMMP2L polyclonal antibody (A01) View larger

IMMP2L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMMP2L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IMMP2L polyclonal antibody (A01)

Brand: Abnova
Reference: H00083943-A01
Product name: IMMP2L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant IMMP2L.
Gene id: 83943
Gene name: IMMP2L
Gene alias: IMP2|IMP2-LIKE
Gene description: IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
Genbank accession: NM_032549
Immunogen: IMMP2L (NP_115938, 31 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR
Protein accession: NP_115938
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083943-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IMMP2L polyclonal antibody (A01) now

Add to cart