No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00083942-M01 |
Product name: | TSSK1B monoclonal antibody (M01), clone 4F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK1B. |
Clone: | 4F12 |
Isotype: | IgG1 Kappa |
Gene id: | 83942 |
Gene name: | TSSK1B |
Gene alias: | FKSG81|SPOGA4|STK22D|TSSK1 |
Gene description: | testis-specific serine kinase 1B |
Genbank accession: | BC022515 |
Immunogen: | TSSK1B (AAH22515, 267 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ |
Protein accession: | AAH22515 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TSSK1B expression in transfected 293T cell line by TSSK1B monoclonal antibody (M01), clone 4F12. Lane 1: TSSK1B transfected lysate(41.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM. Mol Hum Reprod. 2011 Jan;17(1):42-56. Epub 2010 Aug 20. |