Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STK40 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about STK40 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00083931-A01 |
| Product name: | STK40 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant STK40. |
| Gene id: | 83931 |
| Gene name: | STK40 |
| Gene alias: | MGC4796|RP11-268J15.4|SHIK|SgK495 |
| Gene description: | serine/threonine kinase 40 |
| Genbank accession: | NM_032017 |
| Immunogen: | STK40 (NP_114406, 349 a.a. ~ 434 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR |
| Protein accession: | NP_114406 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | STK40 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of STK40 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |