| Brand: | Abnova |
| Reference: | H00083854-M07 |
| Product name: | ANGPTL6 monoclonal antibody (M07), clone 3H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ANGPTL6. |
| Clone: | 3H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83854 |
| Gene name: | ANGPTL6 |
| Gene alias: | AGF|ARP5 |
| Gene description: | angiopoietin-like 6 |
| Genbank accession: | NM_031917 |
| Immunogen: | ANGPTL6 (NP_114123, 211 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI |
| Protein accession: | NP_114123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ANGPTL6 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |