| Brand: | Abnova |
| Reference: | H00083852-M08A |
| Product name: | SETDB2 monoclonal antibody (M08A), clone 2D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SETDB2. |
| Clone: | 2D11 |
| Isotype: | IgM Kappa |
| Gene id: | 83852 |
| Gene name: | SETDB2 |
| Gene alias: | C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F |
| Gene description: | SET domain, bifurcated 2 |
| Genbank accession: | NM_031915 |
| Immunogen: | SETDB2 (NP_114121.1, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED |
| Protein accession: | NP_114121.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |