Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SETDB2 monoclonal antibody (M07), clone 1E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about SETDB2 monoclonal antibody (M07), clone 1E2
| Brand: | Abnova |
| Reference: | H00083852-M07 |
| Product name: | SETDB2 monoclonal antibody (M07), clone 1E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SETDB2. |
| Clone: | 1E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83852 |
| Gene name: | SETDB2 |
| Gene alias: | C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F |
| Gene description: | SET domain, bifurcated 2 |
| Genbank accession: | NM_031915 |
| Immunogen: | SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL |
| Protein accession: | NP_114121.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SETDB2 monoclonal antibody (M07), clone 1E2. Western Blot analysis of SETDB2 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |