Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CALN1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CALN1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00083698-A01 |
| Product name: | CALN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CALN1. |
| Gene id: | 83698 |
| Gene name: | CALN1 |
| Gene alias: | - |
| Gene description: | calneuron 1 |
| Genbank accession: | NM_031468 |
| Immunogen: | CALN1 (NP_113656, 106 a.a. ~ 183 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQ |
| Protein accession: | NP_113656 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Calneurons provide a calcium threshold for trans-Golgi network to plasma membrane trafficking.Mikhaylova M, Reddy PP, Munsch T, Landgraf P, Suman SK, Smalla KH, Gundelfinger ED, Sharma Y, Kreutz MR. Proc Natl Acad Sci U S A. 2009 Jun 2;106(22):9093-8. Epub 2009 May 19. |