| Brand: | Abnova |
| Reference: | H00083596-A01 |
| Product name: | BCL2L12 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BCL2L12. |
| Gene id: | 83596 |
| Gene name: | BCL2L12 |
| Gene alias: | MGC120313|MGC120314|MGC120315 |
| Gene description: | BCL2-like 12 (proline rich) |
| Genbank accession: | BC007724 |
| Immunogen: | BCL2L12 (AAH07724, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD |
| Protein accession: | AAH07724 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |