BCL2L12 polyclonal antibody (A01) View larger

BCL2L12 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCL2L12 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about BCL2L12 polyclonal antibody (A01)

Brand: Abnova
Reference: H00083596-A01
Product name: BCL2L12 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant BCL2L12.
Gene id: 83596
Gene name: BCL2L12
Gene alias: MGC120313|MGC120314|MGC120315
Gene description: BCL2-like 12 (proline rich)
Genbank accession: BC007724
Immunogen: BCL2L12 (AAH07724, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
Protein accession: AAH07724
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083596-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BCL2L12 polyclonal antibody (A01) now

Add to cart