No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00083593-M01 |
Product name: | RASSF5 monoclonal antibody (M01), clone 5C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RASSF5. |
Clone: | 5C2 |
Isotype: | IgG2a Kappa |
Gene id: | 83593 |
Gene name: | RASSF5 |
Gene alias: | MGC10823|MGC17344|Maxp1|NORE1|NORE1A|NORE1B|RAPL|RASSF3 |
Gene description: | Ras association (RalGDS/AF-6) domain family member 5 |
Genbank accession: | NM_031437 |
Immunogen: | RASSF5 (NP_113625, 100 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTL |
Protein accession: | NP_113625 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |