Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MFRP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MFRP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00083552-A01 |
| Product name: | MFRP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MFRP. |
| Gene id: | 83552 |
| Gene name: | MFRP |
| Gene alias: | C1QTNF5|FLJ30570|NNO2|rd6 |
| Gene description: | membrane frizzled-related protein |
| Genbank accession: | NM_031433 |
| Immunogen: | MFRP (NP_113621, 480 a.a. ~ 579 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP |
| Protein accession: | NP_113621 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MFRP polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of MFRP expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |