Cart 2 Product Products 375,67 € (empty)
No products
To be determined Shipping
375,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 375,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 375,67 €
Data sheet of GSG1 monoclonal antibody (M05), clone 1D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about GSG1 monoclonal antibody (M05), clone 1D11
| Brand: | Abnova |
| Reference: | H00083445-M05 |
| Product name: | GSG1 monoclonal antibody (M05), clone 1D11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant GSG1. |
| Clone: | 1D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 83445 |
| Gene name: | GSG1 |
| Gene alias: | MGC111023|MGC3146 |
| Gene description: | germ cell associated 1 |
| Genbank accession: | BC001796.1 |
| Immunogen: | GSG1 (AAH01796.1, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA |
| Protein accession: | AAH01796.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GSG1 monoclonal antibody (M05), clone 1D11. Western Blot analysis of GSG1 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |