Brand: | Abnova |
Reference: | H00083445-M05 |
Product name: | GSG1 monoclonal antibody (M05), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GSG1. |
Clone: | 1D11 |
Isotype: | IgG1 Kappa |
Gene id: | 83445 |
Gene name: | GSG1 |
Gene alias: | MGC111023|MGC3146 |
Gene description: | germ cell associated 1 |
Genbank accession: | BC001796.1 |
Immunogen: | GSG1 (AAH01796.1, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA |
Protein accession: | AAH01796.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (57.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GSG1 monoclonal antibody (M05), clone 1D11. Western Blot analysis of GSG1 expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |