| Brand: | Abnova |
| Reference: | H00083259-A01 |
| Product name: | PCDH11Y polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCDH11Y. |
| Gene id: | 83259 |
| Gene name: | PCDH11Y |
| Gene alias: | PCDH-PC|PCDH11X|PCDH22|PCDHY |
| Gene description: | protocadherin 11 Y-linked |
| Genbank accession: | NM_032973 |
| Immunogen: | PCDH11Y (NP_004733, 57 a.a. ~ 165 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN |
| Protein accession: | NP_004733 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCDH11Y polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of PCDH11Y expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |