Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00081873-B02P |
Product name: | ARPC5L purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ARPC5L protein. |
Gene id: | 81873 |
Gene name: | ARPC5L |
Gene alias: | ARC16-2|MGC3038 |
Gene description: | actin related protein 2/3 complex, subunit 5-like |
Genbank accession: | NM_030978.1 |
Immunogen: | ARPC5L (NP_112240.1, 1 a.a. ~ 153 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
Protein accession: | NP_112240.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ARPC5L expression in transfected 293T cell line (H00081873-T03) by ARPC5L MaxPab polyclonal antibody. Lane 1: ARPC5L transfected lysate(16.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |