No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00081856-M04 |
| Product name: | ZNF611 monoclonal antibody (M04), clone 4F1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ZNF611. |
| Clone: | 4F1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 81856 |
| Gene name: | ZNF611 |
| Gene alias: | MGC5384 |
| Gene description: | zinc finger protein 611 |
| Genbank accession: | BC000918 |
| Immunogen: | ZNF611 (AAH00918, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT |
| Protein accession: | AAH00918 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged ZNF611 is approximately 1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |