| Brand: | Abnova |
| Reference: | H00081790-M01 |
| Product name: | RNF170 monoclonal antibody (M01), clone 2D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF170. |
| Clone: | 2D6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 81790 |
| Gene name: | RNF170 |
| Gene alias: | DKFZp564A022|FLJ38306 |
| Gene description: | ring finger protein 170 |
| Genbank accession: | NM_030954 |
| Immunogen: | RNF170 (NP_112216, 121 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGG |
| Protein accession: | NP_112216 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RNF170 monoclonal antibody (M01), clone 2D6. Western Blot analysis of RNF170 expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |