UNC93B1 polyclonal antibody (A01) View larger

UNC93B1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNC93B1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UNC93B1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00081622-A01
Product name: UNC93B1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UNC93B1.
Gene id: 81622
Gene name: UNC93B1
Gene alias: MGC126617|UNC93|UNC93B
Gene description: unc-93 homolog B1 (C. elegans)
Genbank accession: NM_030930
Immunogen: UNC93B1 (NP_112192, 83 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGT
Protein accession: NP_112192
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081622-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UNC93B1 polyclonal antibody (A01) now

Add to cart