Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLA2G12A monoclonal antibody (M01), clone 1D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PLA2G12A monoclonal antibody (M01), clone 1D11
| Brand: | Abnova |
| Reference: | H00081579-M01 |
| Product name: | PLA2G12A monoclonal antibody (M01), clone 1D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLA2G12A. |
| Clone: | 1D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 81579 |
| Gene name: | PLA2G12A |
| Gene alias: | GXII|PLA2G12|ROSSY |
| Gene description: | phospholipase A2, group XIIA |
| Genbank accession: | NM_030821 |
| Immunogen: | PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD |
| Protein accession: | NP_110448 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Expression of group XIIA phospholipase A2 in human digestive organs.Peuravuori H, Kollanus S, Nevalainen TJ APMIS. 2014 Dec;122(12):1171-7. doi: 10.1111/apm.12280. Epub 2014 May 26. |