Cart 54 Product Products 17 649,32 € (empty)
-
-
1 x 5-LO...259,07 € -
1 x PRP6...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x NGFR p75...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
17 649,32 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 54 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 649,32 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 649,32 €
Data sheet of PLA2G12A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about PLA2G12A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00081579-A01 |
| Product name: | PLA2G12A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PLA2G12A. |
| Gene id: | 81579 |
| Gene name: | PLA2G12A |
| Gene alias: | GXII|PLA2G12|ROSSY |
| Gene description: | phospholipase A2, group XIIA |
| Genbank accession: | NM_030821 |
| Immunogen: | PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD |
| Protein accession: | NP_110448 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A polyclonal antibody (A01). Lane1:PLA2G12A transfected lysate(21.067 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |