| Brand: | Abnova |
| Reference: | H00081035-M01 |
| Product name: | COLEC12 monoclonal antibody (M01), clone 4A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COLEC12. |
| Clone: | 4A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 81035 |
| Gene name: | COLEC12 |
| Gene alias: | CLP1|NSR2|SCARA4|SRCL |
| Gene description: | collectin sub-family member 12 |
| Genbank accession: | BC060789 |
| Immunogen: | COLEC12 (AAH60789, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN |
| Protein accession: | AAH60789 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged COLEC12 is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |