| Brand: | Abnova |
| Reference: | H00080895-M02 |
| Product name: | ILKAP monoclonal antibody (M02), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ILKAP. |
| Clone: | 3B5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 80895 |
| Gene name: | ILKAP |
| Gene alias: | DKFZp434J2031|FLJ10181|MGC4846|PP2C-DELTA |
| Gene description: | integrin-linked kinase-associated serine/threonine phosphatase 2C |
| Genbank accession: | NM_030768 |
| Immunogen: | ILKAP (NP_110395, 293 a.a. ~ 392 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH |
| Protein accession: | NP_110395 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ILKAP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |