| Brand: | Abnova |
| Reference: | H00080854-M01 |
| Product name: | SET7 monoclonal antibody (M01), clone 5B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SET7. |
| Clone: | 5B4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80854 |
| Gene name: | SETD7 |
| Gene alias: | FLJ21193|KIAA1717|KMT7|SET7|SET7/9|SET9 |
| Gene description: | SET domain containing (lysine methyltransferase) 7 |
| Genbank accession: | NM_030648 |
| Immunogen: | SET7 (NP_085151, 257 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK |
| Protein accession: | NP_085151 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SET7 monoclonal antibody (M01), clone 5B4 Western Blot analysis of SET7 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |