| Brand: | Abnova |
| Reference: | H00080833-M01A |
| Product name: | APOL3 monoclonal antibody (M01A), clone 4E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant APOL3. |
| Clone: | 4E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80833 |
| Gene name: | APOL3 |
| Gene alias: | APOLIII|CG12-1 |
| Gene description: | apolipoprotein L, 3 |
| Genbank accession: | NM_145640 |
| Immunogen: | APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG |
| Protein accession: | NP_663615 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | APOL3 monoclonal antibody (M01A), clone 4E5 Western Blot analysis of APOL3 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |