View larger

STARD5 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of STARD5 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00080765-A01
Product name:	STARD5 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant STARD5.
Gene id:	80765
Gene name:	STARD5
Gene alias:	MGC10327
Gene description:	StAR-related lipid transfer (START) domain containing 5
Genbank accession:	NM_181900
Immunogen:	STARD5 (NP_871629, 121 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	LVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFH
Protein accession:	NP_871629
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.23 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice