| Brand: | Abnova |
| Reference: | H00080704-M07 |
| Product name: | SLC19A3 monoclonal antibody (M07), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC19A3. |
| Clone: | 3B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 80704 |
| Gene name: | SLC19A3 |
| Gene alias: | THTR2 |
| Gene description: | solute carrier family 19, member 3 |
| Genbank accession: | NM_025243 |
| Immunogen: | SLC19A3 (NP_079519.1, 191 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR |
| Protein accession: | NP_079519.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC19A3 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |