No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00080381-M51 |
Product name: | CD276 monoclonal antibody (M51), clone 3B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD276. |
Clone: | 3B3 |
Isotype: | IgG1 Kappa |
Gene id: | 80381 |
Gene name: | CD276 |
Gene alias: | B7-H3|B7H3 |
Gene description: | CD276 molecule |
Genbank accession: | BC062581.1 |
Immunogen: | CD276 (AAH62581.1, 28 a.a. ~ 238 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT |
Protein accession: | AAH62581.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |