| Brand: | Abnova |
| Reference: | H00080380-Q01 |
| Product name: | PDCD1LG2 (Human) Recombinant Protein (Q01) |
| Product description: | Human PDCD1LG2 partial ORF ( NP_079515.1, 22 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 80380 |
| Gene name: | PDCD1LG2 |
| Gene alias: | B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2 |
| Gene description: | programmed cell death 1 ligand 2 |
| Genbank accession: | NM_025239 |
| Immunogen sequence/protein sequence: | TVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWD |
| Protein accession: | NP_079515.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |