PDCD1LG2 monoclonal antibody (M46), clone 4G7 View larger

PDCD1LG2 monoclonal antibody (M46), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDCD1LG2 monoclonal antibody (M46), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about PDCD1LG2 monoclonal antibody (M46), clone 4G7

Brand: Abnova
Reference: H00080380-M46
Product name: PDCD1LG2 monoclonal antibody (M46), clone 4G7
Product description: Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
Clone: 4G7
Isotype: IgG1 Kappa
Gene id: 80380
Gene name: PDCD1LG2
Gene alias: B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene description: programmed cell death 1 ligand 2
Genbank accession: BC074766.2
Immunogen: PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA
Protein accession: AAH74766.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080380-M46-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (13.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080380-M46-2-A7-1.jpg
Application image note: PDCD1LG2 monoclonal antibody (M46), clone 4G7. Western Blot analysis of PDCD1LG2 expression in human pancreas.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDCD1LG2 monoclonal antibody (M46), clone 4G7 now

Add to cart