| Brand: | Abnova |
| Reference: | H00080380-M43 |
| Product name: | PDCD1LG2 monoclonal antibody (M43), clone 2E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2. |
| Clone: | 2E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 80380 |
| Gene name: | PDCD1LG2 |
| Gene alias: | B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2 |
| Gene description: | programmed cell death 1 ligand 2 |
| Genbank accession: | BC074766.2 |
| Immunogen: | PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA |
| Protein accession: | AAH74766.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (13.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PDCD1LG2 monoclonal antibody (M43), clone 2E2. Western Blot analysis of PDCD1LG2 expression in Jurkat. |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |