| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00080380-M06 |
| Product name: | PDCD1LG2 monoclonal antibody (M06), clone 7D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2. |
| Clone: | 7D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80380 |
| Gene name: | PDCD1LG2 |
| Gene alias: | B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2 |
| Gene description: | programmed cell death 1 ligand 2 |
| Genbank accession: | NM_025239 |
| Immunogen: | PDCD1LG2 (NP_079515.1, 22 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWD |
| Protein accession: | NP_079515.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PDCD1LG2 expression in transfected 293T cell line by PDCD1LG2 monoclonal antibody (M06), clone 7D5. Lane 1: PDCD1LG2 transfected lysate (Predicted MW: 30.03 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |