No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00080349-D01P |
| Product name: | WDR61 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human WDR61 protein. |
| Gene id: | 80349 |
| Gene name: | WDR61 |
| Gene alias: | REC14|SKI8 |
| Gene description: | WD repeat domain 61 |
| Genbank accession: | NM_025234.1 |
| Immunogen: | WDR61 (NP_079510.1, 1 a.a. ~ 305 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI |
| Protein accession: | NP_079510.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | WDR61 MaxPab rabbit polyclonal antibody. Western Blot analysis of WDR61 expression in mouse brain. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |