WDR61 MaxPab mouse polyclonal antibody (B01) View larger

WDR61 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR61 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about WDR61 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00080349-B01
Product name: WDR61 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human WDR61 protein.
Gene id: 80349
Gene name: WDR61
Gene alias: REC14|SKI8
Gene description: WD repeat domain 61
Genbank accession: NM_025234.1
Immunogen: WDR61 (NP_079510.1, 1 a.a. ~ 305 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI
Protein accession: NP_079510.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080349-B01-13-15-1.jpg
Application image note: Western Blot analysis of WDR61 expression in transfected 293T cell line (H00080349-T01) by WDR61 MaxPab polyclonal antibody.

Lane 1: WDR61 transfected lysate(33.55 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WDR61 MaxPab mouse polyclonal antibody (B01) now

Add to cart