Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF435 monoclonal antibody (M01), clone 4A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ZNF435 monoclonal antibody (M01), clone 4A9
| Brand: | Abnova |
| Reference: | H00080345-M01 |
| Product name: | ZNF435 monoclonal antibody (M01), clone 4A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF435. |
| Clone: | 4A9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 80345 |
| Gene name: | ZSCAN16 |
| Gene alias: | FLJ22191|ZNF392|ZNF435|dJ265C24.3 |
| Gene description: | zinc finger and SCAN domain containing 16 |
| Genbank accession: | NM_025231 |
| Immunogen: | ZNF435 (NP_079507.1, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ |
| Protein accession: | NP_079507.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZSCAN16 expression in transfected 293T cell line by ZNF435 monoclonal antibody (M01), clone 4A9. Lane 1: ZSCAN16 transfected lysate(40.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |