| Brand: | Abnova |
| Reference: | H00080303-M08A |
| Product name: | EFHD1 monoclonal antibody (M08A), clone 1F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EFHD1. |
| Clone: | 1F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80303 |
| Gene name: | EFHD1 |
| Gene alias: | DKFZp781H0842|FLJ13612|MST133|MSTP133|PP3051 |
| Gene description: | EF-hand domain family, member D1 |
| Genbank accession: | NM_025202 |
| Immunogen: | EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN |
| Protein accession: | NP_079478.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EFHD1 monoclonal antibody (M08A), clone 1F5. Western Blot analysis of EFHD1 expression in NIH/3T3(Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |