View larger

pp9099 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of pp9099 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00080301-A01
Product name:	pp9099 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant pp9099.
Gene id:	80301
Gene name:	PLEKHO2
Gene alias:	DKFZp761K2312\|FLJ38884\|PLEKHQ1\|PP1628\|pp9099
Gene description:	pleckstrin homology domain containing, family O member 2
Genbank accession:	NM_025201
Immunogen:	pp9099 (NP_079477, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP
Protein accession:	NP_079477
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice