View larger

HSD3B7 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of HSD3B7 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00080270-A01
Product name:	HSD3B7 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant HSD3B7.
Gene id:	80270
Gene name:	HSD3B7
Gene alias:	PFIC4\|SDR11E3
Gene description:	hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
Genbank accession:	NM_025193
Immunogen:	HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG
Protein accession:	NP_079469
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (38.1 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice