Cart 30 Product Products 11 680,33 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x sMtCK...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
11 680,33 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 30 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 680,33 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 680,33 €
Data sheet of ELL3 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ELL3 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00080237-B02P |
| Product name: | ELL3 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ELL3 protein. |
| Gene id: | 80237 |
| Gene name: | ELL3 |
| Gene alias: | FLJ22637 |
| Gene description: | elongation factor RNA polymerase II-like 3 |
| Genbank accession: | NM_025165.2 |
| Immunogen: | ELL3 (NP_079441.1, 1 a.a. ~ 397 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS |
| Protein accession: | NP_079441.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ELL3 expression in transfected 293T cell line (H00080237-T02) by ELL3 MaxPab polyclonal antibody. Lane 1: ELL3 transfected lysate(43.67 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Selective expression of the transcription elongation factor ELL3 in B cells prior to ELL2 drives proliferation and survival.Alexander LMM, Watters J, Reusch JA, Maurin M, Nepon-Sixt BS, Vrzalikova K, Alexandrow MG, Murray PG, Wright KL. Mol Immunol. 2017 Aug 28;91:8-16. |