| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00080237-B01P |
| Product name: | ELL3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ELL3 protein. |
| Gene id: | 80237 |
| Gene name: | ELL3 |
| Gene alias: | FLJ22637 |
| Gene description: | elongation factor RNA polymerase II-like 3 |
| Genbank accession: | BC019293 |
| Immunogen: | ELL3 (AAH19293, 1 a.a. ~ 397 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS |
| Protein accession: | AAH19293 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ELL3 expression in transfected 293T cell line (H00080237-T01) by ELL3 MaxPab polyclonal antibody. Lane 1: ELL3 transfected lysate(43.78 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Ribavirin-induced intracellular GTP depletion activates transcription elongation in coagulation factor VII gene expression.Suzuki A, Miyawaki Y, Okuyama E, Murata M, Ando Y, Kato I, Takagi Y, Takagi A, Murate T, Saito H, Kojima T. Biochem J. 2012 Oct 11. [Epub ahead of print] |