No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF |
Brand: | Abnova |
Reference: | H00080205-B03P |
Product name: | CHD9 purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CHD9 protein. |
Gene id: | 80205 |
Gene name: | CHD9 |
Gene alias: | AD013|CReMM|KISH2|PRIC320 |
Gene description: | chromodomain helicase DNA binding protein 9 |
Genbank accession: | BC033770.1 |
Immunogen: | CHD9 (AAH33770.1, 1 a.a. ~ 119 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL |
Protein accession: | AAH33770.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of purified MaxPab antibody to CHD9 on 293T cell. [antibody concentration 1 ug/ml] |
Applications: | IF |
Shipping condition: | Dry Ice |