> >>CHD9 purified MaxPab mouse polyclonal antibody (B03P)
CHD9 purified MaxPab mouse polyclonal antibody (B03P) View larger

CHD9 purified MaxPab mouse polyclonal antibody (B03P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of CHD9 purified MaxPab mouse polyclonal antibody (B03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF

More info about CHD9 purified MaxPab mouse polyclonal antibody (B03P)

Brand: Abnova
Reference: H00080205-B03P
Product name: CHD9 purified MaxPab mouse polyclonal antibody (B03P)
Product description: Mouse polyclonal antibody raised against a full-length human CHD9 protein.
Gene id: 80205
Gene name: CHD9
Gene alias: AD013|CReMM|KISH2|PRIC320
Gene description: chromodomain helicase DNA binding protein 9
Genbank accession: BC033770.1
Immunogen: CHD9 (AAH33770.1, 1 a.a. ~ 119 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL
Protein accession: AAH33770.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080205-B03P-4-15-1-L.jpg
Application image note: Immunofluorescence of purified MaxPab antibody to CHD9 on 293T cell. [antibody concentration 1 ug/ml]
Applications: IF
Shipping condition: Dry Ice

Reviews

Buy CHD9 purified MaxPab mouse polyclonal antibody (B03P) now

Add to cart