Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FBXO11 monoclonal antibody (M01A), clone 4C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about FBXO11 monoclonal antibody (M01A), clone 4C12
| Brand: | Abnova |
| Reference: | H00080204-M01A |
| Product name: | FBXO11 monoclonal antibody (M01A), clone 4C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXO11. |
| Clone: | 4C12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80204 |
| Gene name: | FBXO11 |
| Gene alias: | FBX11|FLJ12673|MGC44383|PRMT9|UBR6|UG063H01|VIT1 |
| Gene description: | F-box protein 11 |
| Genbank accession: | NM_025133 |
| Immunogen: | FBXO11 (NP_079409, 744 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN |
| Protein accession: | NP_079409 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |