No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00080201-A02 |
Product name: | HKDC1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HKDC1. |
Gene id: | 80201 |
Gene name: | HKDC1 |
Gene alias: | FLJ22761|FLJ37767|MGC125688 |
Gene description: | hexokinase domain containing 1 |
Genbank accession: | NM_025130 |
Immunogen: | HKDC1 (NP_079406, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD |
Protein accession: | NP_079406 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |