Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DBF4B monoclonal antibody (M01), clone 1A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about DBF4B monoclonal antibody (M01), clone 1A7
| Brand: | Abnova |
| Reference: | H00080174-M01 |
| Product name: | DBF4B monoclonal antibody (M01), clone 1A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DBF4B. |
| Clone: | 1A7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 80174 |
| Gene name: | DBF4B |
| Gene alias: | ASKL1|DRF1|FLJ13087|MGC15009|ZDBF1B|chifb |
| Gene description: | DBF4 homolog B (S. cerevisiae) |
| Genbank accession: | NM_145663 |
| Immunogen: | DBF4B (NP_663696, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG |
| Protein accession: | NP_663696 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DBF4B is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |