| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00080150-M03A |
| Product name: | ASRGL1 monoclonal antibody (M03A), clone 5C8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ASRGL1. |
| Clone: | 5C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80150 |
| Gene name: | ASRGL1 |
| Gene alias: | ALP|ALP1|FLJ22316 |
| Gene description: | asparaginase like 1 |
| Genbank accession: | BC064963 |
| Immunogen: | ASRGL1 (AAH64963, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP |
| Protein accession: | AAH64963 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ASRGL1 expression in transfected 293T cell line by ASRGL1 monoclonal antibody (M03A), clone 5C8. Lane 1: ASRGL1 transfected lysate(32.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |