| Brand: | Abnova |
| Reference: | H00080128-M05 |
| Product name: | TRIM46 monoclonal antibody (M05), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM46. |
| Clone: | 3G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80128 |
| Gene name: | TRIM46 |
| Gene alias: | FLJ23229|GENEY|TRIFIC |
| Gene description: | tripartite motif-containing 46 |
| Genbank accession: | NM_025058 |
| Immunogen: | TRIM46 (NP_079334, 451 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG |
| Protein accession: | NP_079334 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to TRIM46 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |