No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00080128-M05 |
Product name: | TRIM46 monoclonal antibody (M05), clone 3G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM46. |
Clone: | 3G11 |
Isotype: | IgG2a Kappa |
Gene id: | 80128 |
Gene name: | TRIM46 |
Gene alias: | FLJ23229|GENEY|TRIFIC |
Gene description: | tripartite motif-containing 46 |
Genbank accession: | NM_025058 |
Immunogen: | TRIM46 (NP_079334, 451 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG |
Protein accession: | NP_079334 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to TRIM46 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |