Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of YSK4 monoclonal antibody (M01), clone 2A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about YSK4 monoclonal antibody (M01), clone 2A4
| Brand: | Abnova |
| Reference: | H00080122-M01 |
| Product name: | YSK4 monoclonal antibody (M01), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant YSK4. |
| Clone: | 2A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 80122 |
| Gene name: | YSK4 |
| Gene alias: | FLJ23074|RCK |
| Gene description: | YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae) |
| Genbank accession: | BC034417 |
| Immunogen: | YSK4 (AAH34417, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR |
| Protein accession: | AAH34417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged YSK4 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M. Chembiochem. 2016 Jan;17(2):181-9. doi: 10.1002/cbic.201500519. Epub 2015 Dec 9. |