Cart 16 Product Products 4 439,37 € (empty)
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-Sh...259,07 € -
-
-
-
-
No products
To be determined Shipping
4 439,37 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 16 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 439,37 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 439,37 €
Data sheet of YSK4 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about YSK4 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00080122-B01P |
| Product name: | YSK4 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human YSK4 protein. |
| Gene id: | 80122 |
| Gene name: | YSK4 |
| Gene alias: | FLJ23074|RCK |
| Gene description: | YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae) |
| Genbank accession: | BC034417.1 |
| Immunogen: | YSK4 (AAH34417.1, 1 a.a. ~ 168 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR |
| Protein accession: | AAH34417.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of YSK4 expression in transfected 293T cell line (H00080122-T02) by YSK4 MaxPab polyclonal antibody. Lane 1: YSK4 transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |