| Brand: | Abnova |
| Reference: | H00080055-M01 |
| Product name: | PGAP1 monoclonal antibody (M01), clone 5G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PGAP1. |
| Clone: | 5G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 80055 |
| Gene name: | PGAP1 |
| Gene alias: | Bst1|FLJ42774|ISPD3024 |
| Gene description: | post-GPI attachment to proteins 1 |
| Genbank accession: | NM_024989 |
| Immunogen: | PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL |
| Protein accession: | NP_079265 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PGAP1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |