| Brand: | Abnova |
| Reference: | H00080055-A01 |
| Product name: | PGAP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PGAP1. |
| Gene id: | 80055 |
| Gene name: | PGAP1 |
| Gene alias: | Bst1|FLJ42774|ISPD3024 |
| Gene description: | post-GPI attachment to proteins 1 |
| Genbank accession: | NM_024989 |
| Immunogen: | PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL |
| Protein accession: | NP_079265 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Ras activation induces expression of raet1 family NK receptor ligands.Liu XV, Ho SS, Tan JJ, Kamran N, Gasser S. J Immunol. 2012 Aug 15;189(4):1826-34. Epub 2012 Jul 13. |