View larger

PGAP1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PGAP1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00080055-A01
Product name:	PGAP1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PGAP1.
Gene id:	80055
Gene name:	PGAP1
Gene alias:	Bst1\|FLJ42774\|ISPD3024
Gene description:	post-GPI attachment to proteins 1
Genbank accession:	NM_024989
Immunogen:	PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
Protein accession:	NP_079265
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Ras activation induces expression of raet1 family NK receptor ligands.Liu XV, Ho SS, Tan JJ, Kamran N, Gasser S. J Immunol. 2012 Aug 15;189(4):1826-34. Epub 2012 Jul 13.