Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TAIP-2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TAIP-2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00080034-A01 |
| Product name: | TAIP-2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TAIP-2. |
| Gene id: | 80034 |
| Gene name: | CSRNP3 |
| Gene alias: | FAM130A2|FLJ11703|FLJ32093|FLJ44141|TAIP-2|TAIP2 |
| Gene description: | cysteine-serine-rich nuclear protein 3 |
| Genbank accession: | NM_024969 |
| Immunogen: | TAIP-2 (NP_079245, 476 a.a. ~ 585 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QFVDYARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV |
| Protein accession: | NP_079245 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |