Brand: | Abnova |
Reference: | H00080028-M01 |
Product name: | FBXL18 monoclonal antibody (M01), clone 3H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXL18. |
Clone: | 3H5 |
Isotype: | IgG1 Kappa |
Gene id: | 80028 |
Gene name: | FBXL18 |
Gene alias: | FLJ10776|FLJ11467|FLJ26934|FLJ38075|FLJ41541|Fbl18 |
Gene description: | F-box and leucine-rich repeat protein 18 |
Genbank accession: | NM_024963 |
Immunogen: | FBXL18 (NP_079239, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS |
Protein accession: | NP_079239 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |