Cart 32 Product Products 12 445,00 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...360,00 € -
-
-
-
-
-
-
No products
To be determined Shipping
12 445,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 32 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 445,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 445,00 €
Data sheet of PLEKHH3 monoclonal antibody (M03), clone 4F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLEKHH3 monoclonal antibody (M03), clone 4F8
| Brand: | Abnova |
| Reference: | H00079990-M03 |
| Product name: | PLEKHH3 monoclonal antibody (M03), clone 4F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLEKHH3. |
| Clone: | 4F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79990 |
| Gene name: | PLEKHH3 |
| Gene alias: | FLJ21019 |
| Gene description: | pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 |
| Genbank accession: | NM_024927 |
| Immunogen: | PLEKHH3 (NP_079203, 665 a.a. ~ 750 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP |
| Protein accession: | NP_079203 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |